Winmispira thermophila DSM 6578: Spith_1094 Help Entry Spith_1094        CDS       T02016                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism stq  Winmispira thermophila DSM 6578 Pathway stq01100   Metabolic pathways stq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Spith_1094    00074 Mycolic acid biosynthesis     Spith_1094   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Spith_1094 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AEJ61366 UniProt:  G0GDL9 LinkDB All DBs Position 1222069..1222311 Genome browser AA seq 80 aa AA seqDB search MDELFEKMKKLIAEKLEIEEDKITLDSSFRQDLGADSLDTYELVYAIEEELGITIPDEKA NEFETVRDALEFIKAELEKK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggacgaactctttgaaaagatgaagaaacttatcgccgaaaagctcgagatcgaggaa gacaagatcaccctggattcctctttccgtcaggatcttggggcggatagcctcgatacg tacgagctcgtatatgccatcgaagaggaactggggatcaccatccctgacgaaaaggcc aatgagtttgagacggtgcgcgatgcgcttgaattcataaaggcagaattggagaagaaa taa

DBGET integrated database retrieval system