Sporosarcina trichiuri: QWT68_14330 Help Entry QWT68_14330       CDS       T10169                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism strb  Sporosarcina trichiuri Brite KEGG Orthology (KO) [BR:strb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:strb03110]     QWT68_14330 (groES)    03029 Mitochondrial biogenesis [BR:strb03029]     QWT68_14330 (groES) Chaperones and folding catalysts [BR:strb03110]  Heat shock proteins   HSP10    QWT68_14330 (groES) Mitochondrial biogenesis [BR:strb03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     QWT68_14330 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  WJY27196 LinkDB All DBs Position 2837735..2838016 Genome browser AA seq 93 aa AA seqDB search MLKPLGDRIVIELIEVEEKTSSGIVLPDSAKEKPQEGKVIAVGTGRILDNGQRVEPEVKE GDRIIFSKYAGTEVKYEGNEYLILRESDILATI NT seq 282 nt NT seq  +upstreamnt  +downstreamnt ttgttgaaaccattaggtgatcgtattgtaattgaactgatcgaagtggaagagaaaacg tcaagcggcatcgtgctgccggattccgcaaaagagaagccgcaggaagggaaagtcatt gctgtcggtacaggacgcattctcgacaatggccagcgtgttgagccggaagtcaaagaa ggcgaccgcatcatcttctcaaaatatgcaggcactgaagtgaaatatgaaggcaatgaa tacttgatcttgcgcgaaagcgatatactggcaacaatctga

DBGET integrated database retrieval system