KEGG   Streptomyces sp. CNQ-509: AA958_21095
Entry
AA958_21095       CDS       T03968                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc01057  Biosynthesis of type II polyketide products
strc01100  Metabolic pathways
strc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    AA958_21095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:strc01008]
    AA958_21095
Polyketide biosynthesis proteins [BR:strc01008]
 Polyketide tailoring proteins
  Others
   AA958_21095
SSDB
Motif
Pfam: PrmA
Other DBs
NCBI-ProteinID: AKH84273
UniProt: A0A0F7N9T9
LinkDB
Position
4901430..4902518
AA seq 362 aa
MSALKFARAALAGALLVAAVTSSSFVAHAEGEIGNGTGNVEEPPSGPGGGAEGQNLYAEA
GGVVFDESENGGGGGSGGSGGGGALEPVGDWAPPPCWYAPLYTPRQLKKEMEHTWSLEST
GYQWDAEQRAKYSQGGDKPGTYEDFNMAKSGDGYWWDGYVPDGGAGVPRALDCDDGPFWV
DEGDPPPAEYQDAVTPQILSEIAYNRIRVPDTEINLKPDAENAQKVNLPTWAWLDAATFE
PVSVTAEVPVLGIWARTTATPVSLTLDPGTADAELHPSSGTCPINDDGSIGTPYTAGSAE
ETPPCGLTYLRATPDGETYTFRATINWSIEWEGSGDTGGDLPDGSFGATTELEVDEIQSV
VR
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgtcagccctgaaattcgcgcgcgcggcgttagccggggcgttacttgtcgccgctgtc
acgagcagcagcttcgtggcgcatgcggaaggggagatcggcaacggcaccggcaatgtc
gaagagccacccagcggcccgggtggcggtgccgaagggcagaatctgtacgccgaggcc
ggtggggtggtgttcgatgagtctgagaacgggggcgggggtggctccggggggtccggg
ggaggcggggcgttggagcccgtgggggactgggcgccgccgccctgttggtacgcgccg
ctctacacacccaggcaactgaagaaagagatggagcacacctggtccctggagtccacc
ggctaccagtgggacgccgagcagcgcgcgaagtactcccagggcggggacaagcccggc
acctacgaggacttcaacatggccaagtccggcgacggctactggtgggacggctacgtg
ccggacggcggtgctggtgtcccccgtgcgctggactgtgacgacgggccgttctgggtg
gacgagggcgatccgccgccggcggagtatcaggacgccgtgacgccgcagatcctctcc
gagatcgcgtacaaccgcatccgcgtgccggacacggagatcaacctcaagcccgacgcc
gagaacgctcagaaggtgaatctccccacctgggcctggctggacgccgccaccttcgaa
cccgtctcggtcaccgcggaggtcccggtgctcgggatatgggccagaaccacggccacc
ccggtgtccctcaccctcgaccccggcaccgccgacgccgagctgcacccctcctcgggc
acctgccccatcaacgacgacggctccatcggcaccccgtacaccgcgggatccgcggag
gagaccccgccctgcgggctgacgtacctgcgtgccacgccggacggtgagacctacacg
ttccgcgcgacgatcaactggtccatcgaatgggagggttccggcgacacgggcggtgat
ctgcccgacggctccttcggcgcgaccaccgagctggaggtcgacgagatccagtccgtc
gtccgatga

DBGET integrated database retrieval system