Streptomyces sp. CNQ-509: AA958_22220 Help Entry AA958_22220       CDS       T03968                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism strc  Streptomyces sp. CNQ-509 Pathway strc00074   Mycolic acid biosynthesis strc00280   Valine, leucine and isoleucine degradation strc00630   Glyoxylate and dicarboxylate metabolism strc00640   Propanoate metabolism strc01100   Metabolic pathways strc01110   Biosynthesis of secondary metabolites strc01120   Microbial metabolism in diverse environments strc01200   Carbon metabolism Module strc_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:strc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     AA958_22220    00640 Propanoate metabolism     AA958_22220   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     AA958_22220   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     AA958_22220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  AKH84460 UniProt:  A0A0F7N792 LinkDB All DBs Position complement(5134644..5134856) Genome browser AA seq 70 aa AA seqDB search MSDEIKVVRGNPTAEELAAALAVVQARAASSVPGGRGGPAGEWADPARRVLARRTPQPGP KAWRTTYWPS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtccgacgagatcaaggtggtccggggcaacccgacggcggaggaactggcggcggcg ctggcggtggtccaggcgcgggcggcgtcgtccgtgccgggcgggcggggcggtcccgcc ggcgagtgggcggatccggcgcggcgggtgctggcccggcggacgccgcagccggggccg aaggcgtggcgtacgacgtactggccgtcgtag

DBGET integrated database retrieval system