Streptomyces sp. CNQ-509: AA958_30250 Help Entry AA958_30250       CDS       T03968                                  Name (GenBank) polyketide synthase   KO K15926   cyclase Organism strc  Streptomyces sp. CNQ-509 Pathway strc01057   Biosynthesis of type II polyketide products strc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strc00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01057 Biosynthesis of type II polyketide products     AA958_30250  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strc01008]     AA958_30250 Polyketide biosynthesis proteins [BR:strc01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Nonaketide PKS      AA958_30250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cyclase_polyket Motif Other DBs NCBI-ProteinID:  AKH85790 UniProt:  A0A0F7NBA5 LinkDB All DBs Position 7092265..7092597 Genome browser AA seq 110 aa AA seqDB search MHRSTLIVARMAPDSAADVARLFERFDGTDMPGRMGTTRRQLFSFHGLYFHLQDFASGEG EERIEGAKDDPRFVRISDDLKPYIEPYDPVTWRSPRDAMATRFYAWEAGA NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgcaccgcagcaccctgatcgtggcccggatggcgccggactccgccgccgacgtggcc cggctgttcgagcggttcgacgggaccgacatgcccgggcgcatgggcaccacgcgccgg cagctcttcagcttccacgggctctacttccacctccaggacttcgcgtccggcgagggc gaagagcgcatcgagggggccaaggacgacccccgcttcgtgcgcatcagcgacgacctc aagccgtacatcgagccgtacgaccccgtgacctggcgctcgccgcgcgacgccatggcc acacgcttctacgcctgggaggcgggcgcatga

DBGET integrated database retrieval system