Streptomyces sp. CCM_MD2014: NI25_24010 Help Entry NI25_24010        CDS       T04862                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism strd  Streptomyces sp. CCM_MD2014 Brite KEGG Orthology (KO) [BR:strd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:strd03032]     NI25_24010    03036 Chromosome and associated proteins [BR:strd03036]     NI25_24010    03400 DNA repair and recombination proteins [BR:strd03400]     NI25_24010 DNA replication proteins [BR:strd03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     NI25_24010 Chromosome and associated proteins [BR:strd03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     NI25_24010 DNA repair and recombination proteins [BR:strd03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       NI25_24010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG Motif Other DBs NCBI-ProteinID:  AIV36162 UniProt:  A0A0N6ZMH5 LinkDB All DBs Position 5405212..5405493 Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAAFAEVVGDIVSKGDEKVTIPGFLTFERTHRAART ARNPQTGDPIQIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgcgctggccgaccgcgccgaggtgacccgcaaggac gccgacgccgtgctggccgcgttcgccgaggttgtcggcgacatcgtctccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gcccgcaacccgcagaccggcgacccgatccagatccccgccgggtacagcgtcaaggtt tcggcgggctccaagctcaaggaagccgccaagggcaagtaa

DBGET integrated database retrieval system