Streptomyces sp. CCM_MD2014: NI25_27145 Help Entry NI25_27145        CDS       T04862                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism strd  Streptomyces sp. CCM_MD2014 Pathway strd00998   Biosynthesis of various antibiotics strd01100   Metabolic pathways strd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NI25_27145    00074 Mycolic acid biosynthesis     NI25_27145   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NI25_27145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AIV36695 LinkDB All DBs Position complement(6145518..6145766) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLADIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDATKYILDHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgcggacatcgtgaacgagatcgcc ggcatcccggttgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tccctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgaggacgtcaagaacctcaagacggtcggcgacgcgacgaagtacatcctcgaccac caggcctga

DBGET integrated database retrieval system