KEGG   Streptomyces sp. 769: GZL_05925
Entry
GZL_05925         CDS       T03587                                 
Name
(GenBank) putative taurine catabolism dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
stre  Streptomyces sp. 769
Pathway
stre00430  Taurine and hypotaurine metabolism
stre00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:stre00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    GZL_05925
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    GZL_05925
Enzymes [BR:stre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     GZL_05925
SSDB
Motif
Pfam: TauD DUF6525
Other DBs
NCBI-ProteinID: AJC58498
LinkDB
Position
complement(6410541..6411488)
AA seq 315 aa
MTTRADDPSARTPALRPHRIPADGLHEGRRILRRTPDGWRDRPYELFEVVPQAATIGAEI
RGLDLSRPLSTALRAELNRALLEWKGLFFRGQHLTSAAQRQFAANWGELETNPLLAPGDS
KEVVRFDKAAGGVPTFENVWHTDVTFRARPAMGAVLQLREVPPSGGDTLWADMAAAYDNL
PPKIRARMNYARAIHDYLPGFSRFSSPAQLARFQAEFPPVEHPVVRRHPETGRRMLFVNA
SFTTRIVGLPEAESDRLLRLLFQQAHVPEFQVRFRWQAGDVAFWDNRATQHYAVFDYGAR
RRVAERVAIAGDRPY
NT seq 948 nt   +upstreamnt  +downstreamnt
ttgaccacccgtgccgacgacccttccgcccgcacgcccgcactgcgcccccaccgcatc
cccgccgacgggctccacgagggccggcggatcctgcgccgcaccccggacggctggcgg
gaccggccctacgagctgttcgaggtcgtcccgcaggccgccaccatcggggcggagatc
cgggggctggatctgtcgcgtccactgtccacggcgctgcgcgcggagctgaaccgggcg
ctgctggagtggaaggggctgttcttccgcgggcagcatctgacctccgccgcacaacgt
caattcgccgccaattggggggagttggagaccaacccgctgctcgccccgggcgactcg
aaggaggtggtgaggtttgacaaggcggccggaggcgtgccgacgttcgagaacgtatgg
cacacggacgtaaccttccgcgcgcggccggcgatgggcgcggtgttgcagctccgcgag
gtcccgccgtcgggcggggacaccctgtgggccgacatggcagcggcctatgacaatttg
ccgccgaaaatccgggcacggatgaattacgcgcgagcgatccacgactatctcccgggg
ttctcccgcttctcctcgccggctcaactcgcgcgattccaggcggagttcccgccggtg
gagcatccggtggtgcgccggcacccggagaccgggcggcggatgctgtttgtcaacgca
tccttcaccacccggatcgtggggctgccggaggcggagagcgaccggctgctgcggctg
ttgttccagcaggcgcacgtaccggagttccaggtgcggttccgctggcaggccggggac
gtcgcgttctgggacaaccgcgccacccagcactacgcggtgttcgactacggcgcgcgg
cggcgggtcgcggagcgggtggcgatcgccggggaccggccgtactag

DBGET integrated database retrieval system