Streptomyces sp. 769: GZL_09104 Help Entry GZL_09104         CDS       T03587                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism stre  Streptomyces sp. 769 Pathway stre03060   Protein export stre03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:stre00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GZL_09104  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     GZL_09104  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:stre02044]     GZL_09104 Secretion system [BR:stre02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    GZL_09104 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AJC61627 UniProt:  A0A0A8F107 LinkDB All DBs Position 9678633..9678962 Genome browser AA seq 109 aa AA seqDB search MLRNGLEPWHLLIVAIVVIVLFGSKKLPDSARALGKSLRILKSEAKAMKEDGASTAPQQP GPPTPPEPEPRTIHAAPGSPATGRAEPVHPAGEPAPPASPTQAGPGPSA NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgctgcgcaacggactggagccatggcacctgctgatcgtggcaatcgtggtgatcgtc ctcttcggctccaagaaactgccggacagcgcccgcgcactgggcaagtcactgcggatc ctcaagagcgaggccaaggcgatgaaggaggacggcgcctcgaccgccccccagcagccc ggccccccgaccccgccggaaccggagccgcgcaccatccatgccgcgcccggcagcccg gccaccgggcgcgccgagcccgtccacccggccggcgagcccgcgccgcccgcttccccc acgcaggccggccccggaccctccgcctga

DBGET integrated database retrieval system