Streptomyces sp. 4F: ASR50_02405 Help Entry ASR50_02405       CDS       T04265                                  Name (GenBank) translocase   KO K03116   sec-independent protein translocase protein TatA Organism strf  Streptomyces sp. 4F Pathway strf03060   Protein export strf03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:strf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     ASR50_02405  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     ASR50_02405  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:strf02044]     ASR50_02405 Secretion system [BR:strf02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    ASR50_02405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ALV48374 LinkDB All DBs Position complement(610230..610469) Genome browser AA seq 79 aa AA seqDB search MFGLSELAIILIVVIAIMLAKKGPELARNAGKSARILKAEARAMKEAEEQQATDTPPRVI RGETIPNRTEQPPADGTRP NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgttcggactgagcgaactggccatcatcctcatcgtcgtcatcgcgatcatgctggcc aagaagggccccgaactggcgcgcaacgcgggcaagtcggcgcgcatcctcaaggccgag gcgcgcgccatgaaggaggcggaggagcagcaggcgacggacacgcctccccgggtcatc cggggcgagacgatcccgaaccgcacggagcagccgccggcggacggtacgcgcccgtag

DBGET integrated database retrieval system