Streptomyces sp. 4F: ASR50_11565 Help Entry ASR50_11565       CDS       T04265                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism strf  Streptomyces sp. 4F Pathway strf01100   Metabolic pathways strf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ASR50_11565    00074 Mycolic acid biosynthesis     ASR50_11565   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ASR50_11565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ALV49993 LinkDB All DBs Position 2605556..2605804 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATDYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgcggagatcgtgaacgagatcgcc ggcatcccggttgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgacgacgtcaagaacctcaagaccgtcggcgacgcgaccgactacatcctcaagcac caggcctga

DBGET integrated database retrieval system