KEGG   Streptomyces sp. 4F: ASR50_22930
Entry
ASR50_22930       CDS       T04265                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
strf  Streptomyces sp. 4F
Pathway
strf01057  Biosynthesis of type II polyketide products
strf01100  Metabolic pathways
strf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strf00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    ASR50_22930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:strf01008]
    ASR50_22930
Polyketide biosynthesis proteins [BR:strf01008]
 Polyketide tailoring proteins
  Others
   ASR50_22930
SSDB
Other DBs
NCBI-ProteinID: ALV51976
LinkDB
Position
5092237..5093274
AA seq 345 aa
MPAVARISVGAAFMAALTVLASSPTAHADFVPGGNGTGSETQVDGDQGDGTISATAGAVV
FDRSKNGTGQKAGPVTSATTWTPPACYYAPKYTPEQLQKYLEPIWEAGSTGHEWDLSQRK
RYVEGEPYKDFNKEKTGEGYWWDSYVTPGRIGDPGALDCDEPFFWVDTNDDPPADIPQAI
TPEMLAQLAYAEIRVPTTEVDLAPDGETKVNLPTWIWLDGADFKPVSVTASVPLLGIQAT
TTAEPVSVRIEPGTSDAETYPASGVCEITNGRIGEPYARGNANRTPPCGVKYLRSSGDDA
YQLQATVTWKIHWTGTGVADEQRLPDGTFGGEQDVVVQEIQSVNR
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgccagccgtagcgaggatctcggtgggcgcggccttcatggccgcactcactgtgctg
gcctcaagcccgacggcacatgccgacttcgtgccgggcggcaacggaacgggtagcgag
acacaggtcgacggtgaccagggcgacgggacgatctcggcgacggcgggagccgtcgtg
ttcgaccgctcgaagaacggaaccggtcagaaggccggccccgtcacctccgccaccacc
tggaccccgcctgcctgctactacgcgccgaagtacaccccggagcagctgcagaagtat
ctggagccgatctgggaggcagggagtacgggacacgagtgggacctctcgcagcgcaaa
cggtatgtcgagggcgagccctacaaggacttcaacaaggagaagaccggtgagggctac
tggtgggactcctatgtcacgccgggccgcatcggtgacccgggggcgctcgactgcgac
gagcccttcttctgggtggacaccaacgacgatccgcccgccgacatcccgcaggccatc
actcccgaaatgctggcgcagctcgcctatgccgagatccgtgtccccacgaccgaggtg
gacctcgctccggacggggagaccaaggtgaacctgccgacctggatatggctggacggg
gcggatttcaagccggtctcggtgacggcttccgtgcccctgctgggtatccaggcgacc
accacggccgagccggtgtccgtcaggatcgaaccgggtacctccgacgcggagacgtac
ccggcctccggtgtctgcgagatcaccaacggccgcatcggtgagccgtacgctaggggg
aatgcgaaccgcacgccgccgtgcggggtgaagtacctgcgctcttccggcgacgacgcc
taccagctccaggctacggtcacttggaaaatccactggaccggcaccggagtcgccgat
gagcagcggctgccggacggcacattcggcggagagcaggacgtcgtcgtccaggagatc
cagtccgtcaaccgctga

DBGET integrated database retrieval system