KEGG   Streptococcus troglodytae: SRT_04840
Entry
SRT_04840         CDS       T06912                                 

Symbol
exoA
Name
(GenBank) exodeoxyribonuclease III
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
strg  Streptococcus troglodytae
Pathway
strg03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:strg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SRT_04840 (exoA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:strg03400]
    SRT_04840 (exoA)
Enzymes [BR:strg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     SRT_04840 (exoA)
DNA repair and recombination proteins [BR:strg03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     SRT_04840 (exoA)
SSDB
Motif
Pfam: Exo_endo_phos
Other DBs
NCBI-ProteinID: BAQ23745
UniProt: A0A1L7LHQ0
LinkDB
Position
complement(482901..483728)
AA seq 275 aa
MKLISWNIDSLNAALTSDSARALLSRAVLDTLMEQDADILAIQETKLSAKGPTKKHLRIL
KDYFPDYDVVWRSSVEPARKGYAGTMFLYKSSLQPTITYPEIGAPATMDDEGRIITLEFD
DFFVTQVYTPNAGDGLKRLDDRQIWDEKYAVYLAQLDKQKPVLATGDYNVAHKEIDLAHP
SSNRRSPGFTDEERAGFTHLLEQGFTDTFRYIHGDVPNVYSWWAQRSKTSKINNSGWRID
YWLTSNRLSDKILKSEMIDSGTRQDHTPILLNIDL
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaaacttatctcatggaatatcgattccctcaacgctgccttgaccagtgattctgcg
cgtgctttactttcacgtgctgttctggacacacttatggaacaagatgctgatatcttg
gctattcaggagacaaagctatctgccaaaggtcccacgaaaaaacatttgcgtattctc
aaggattatttccccgactatgatgttgtttggcgttcttcagtggagcctgcgcgtaaa
ggttatgctggaaccatgtttctctacaaatcaagcttgcaacctaccatcacctatcca
gaaatcggcgctcctgcaaccatggatgacgaagggcgtatcatcaccttagaatttgat
gatttctttgttactcaggtttatacaccaaatgctggtgatggccttaaacgccttgat
gatcgtcaaatttgggatgaaaagtatgccgtttatctggctcaattagataagcaaaaa
cctgttctggcaacaggcgactataatgttgcccacaaggaaattgatctcgctcatcct
tcttccaatcgccgttcaccaggctttacagatgaagaacgggctggttttactcattta
ttggaacaaggctttactgacactttccgctatattcatggggatgtgcctaatgtttac
agctggtgggctcaacgcagcaagaccagcaagattaacaattcaggctggagaattgac
tattggctaaccagcaatcgactaagcgataaaattctcaaatctgaaatgattgattca
ggaactcgtcaagaccatacccctattctgctgaatattgatttataa

DBGET integrated database retrieval system