KEGG   Streptococcus troglodytae: SRT_05150
Entry
SRT_05150         CDS       T06912                                 

Symbol
fpg
Name
(GenBank) formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
strg  Streptococcus troglodytae
Pathway
strg03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:strg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SRT_05150 (fpg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:strg03400]
    SRT_05150 (fpg)
Enzymes [BR:strg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SRT_05150 (fpg)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SRT_05150 (fpg)
DNA repair and recombination proteins [BR:strg03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SRT_05150 (fpg)
SSDB
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS NFACT_N Auto_anti-p27
Other DBs
NCBI-ProteinID: BAQ23776
UniProt: A0A1L7LHX0
LinkDB
Position
506849..507667
AA seq 272 aa
MPELPEVETVRRGLEHLIVGKKIVSVEVRVPKMVKTGVEDFQLDILGQIFESIDRRGKYL
LLNLNKQTIISHLRMEGKYLLFENEVPDNKHFHLFLGLDDGSTMVYQDVRKFGTFELLPK
SQVEAYFIQKKIGPEPKAEDFKLKPFEEGLAKSHKAIKTLLLDQHLVAGLGNIYVDEVLW
ASQIHPERPASGLTEEEAVLLRQQIIRIMQLAIKNGGSTIRTYRNALGEDGSMQDFLQVY
GKTDQPCGRCATPIEKIKVGGRGTHFCPSCQK
NT seq 819 nt   +upstreamnt  +downstreamnt
atgccagaattaccagaggttgaaacggtcaggcgcggcttggagcatttgattgttggc
aaaaaaattgtatcggtagaggttcgtgtgcccaaaatggtcaaaacgggtgtagaagat
tttcagctggacattttaggacaaatttttgaaagtattgatcgccgtggtaaatatctc
cttttaaatctcaataagcagaccattatttctcatctgcgcatggaaggcaagtatttg
ctttttgaaaatgaggtgcctgacaataagcattttcatcttttcttaggtctggatgat
gggtcaaccatggtctatcaggatgtccgcaaatttggtacctttgaattattgcctaag
agtcaggtcgaggcttattttattcagaaaaaaattggtcctgaacccaaggccgaagac
tttaagctcaagccttttgaagaaggactggccaaatcgcacaaggccatcaaaacatta
cttttggatcagcatttggtggctggacttggcaatatctatgtggatgaggtcttgtgg
gcaagtcagattcatccagaacgtcctgcttccggtttaactgaggaagaagccgtgcta
ttgcgtcagcaaattattcgtatcatgcagctggccattaaaaatggcggttcgaccatt
cgcacttatcgcaatgctcttggcgaagatggcagtatgcaggatttcttacaagtttat
ggaaagacagatcagccttgtgggcgctgtgccacgcctattgagaaaattaaagtagga
gggagagggacgcatttttgcccatcctgccaaaaatga

DBGET integrated database retrieval system