Streptococcus troglodytae: SRT_11130 Help Entry SRT_11130         CDS       T06912                                  Name (GenBank) 6-phospho-beta-glucosidase   KO K01223   6-phospho-beta-glucosidase [EC:3.2.1.86] Organism strg  Streptococcus troglodytae Pathway strg00010   Glycolysis / Gluconeogenesis strg00500   Starch and sucrose metabolism Brite KEGG Orthology (KO) [BR:strg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     SRT_11130    00500 Starch and sucrose metabolism     SRT_11130 Enzymes [BR:strg01000]  3. Hydrolases   3.2  Glycosylases    3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds     3.2.1.86  6-phospho-beta-glucosidase      SRT_11130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glyco_hydro_1 Swi6_N Motif Other DBs NCBI-ProteinID:  BAQ24374 UniProt:  A0A1L7LJJ0 LinkDB All DBs Position complement(1129516..1129680) Genome browser AA seq 54 aa AA seqDB search MFSASTAQLSKRYGFIYVDRNDDGSGSLARYKKNHLFGIKRLLKVMVPVSMNEY NT seq 165 nt NT seq  +upstreamnt  +downstreamnt ttgttttctgcatcaactgcacaacttagtaaacgctatggttttatctatgttgatcgc aacgatgatggttctggaagtttggcgcgctataagaaaaatcatttgtttggtataaaa aggttattgaaagtaatggtgccagtctctatgaatgaatattga

DBGET integrated database retrieval system