Streptococcus troglodytae: SRT_16630 Help Entry SRT_16630         CDS       T06912                                  Symbol ftsL Name (GenBank) cell division protein   KO K03586   cell division protein FtsL Organism strg  Streptococcus troglodytae Brite KEGG Orthology (KO) [BR:strg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:strg03036]     SRT_16630 (ftsL) Chromosome and associated proteins [BR:strg03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     SRT_16630 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC FtsL_2 DUF948 FtsL DUF724 Spc24 DUF6377 BRE1 DUF5964 V-ATPase_C Mod_r Prefoldin_2 SPC22 NuA4 Swi5 Vpu Motif Other DBs NCBI-ProteinID:  BAQ24924 UniProt:  A0A1L7LL39 LinkDB All DBs Position complement(1676346..1676669) Genome browser AA seq 107 aa AA seqDB search MTNEKRSEALSQALQKRIKTFTRLEKAFYGAIIITAITLAVSIIYLQSRSLQIQQEISHL NSQINDRETEYNNAKQEVNELSRYDRIAEIAQKAGLTVQKDNIKKVD NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgacaaatgaaaaacggagcgaagctctctctcaagctttacaaaaaagaatcaaaacc tttaccagattggaaaaggctttttatggtgcgattattattactgctatcacactggct gttagtattatttatttgcaaagccgcagcctgcaaattcagcaggaaatcagccattta aacagtcaaatcaatgacagagagactgaatataataatgctaaacaggaagttaatgaa ctgagccgttatgatcgtattgcggaaattgctcaaaaagcaggccttactgtgcaaaaa gataatattaagaaggtggactag

DBGET integrated database retrieval system