KEGG   Streptococcus troglodytae: SRT_18080
Entry
SRT_18080         CDS       T06912                                 

Symbol
polI
Name
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
strg  Streptococcus troglodytae
Pathway
strg03030  DNA replication
strg03410  Base excision repair
strg03420  Nucleotide excision repair
strg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:strg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SRT_18080 (polI)
   03410 Base excision repair
    SRT_18080 (polI)
   03420 Nucleotide excision repair
    SRT_18080 (polI)
   03440 Homologous recombination
    SRT_18080 (polI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:strg03032]
    SRT_18080 (polI)
   03400 DNA repair and recombination proteins [BR:strg03400]
    SRT_18080 (polI)
Enzymes [BR:strg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SRT_18080 (polI)
DNA replication proteins [BR:strg03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     SRT_18080 (polI)
DNA repair and recombination proteins [BR:strg03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     SRT_18080 (polI)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SRT_18080 (polI)
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc
Other DBs
NCBI-ProteinID: BAQ25069
UniProt: A0A1L7LLN4
LinkDB
Position
complement(1815704..1818340)
AA seq 878 aa
MTNKKKLLLIDGSSVAYRAFFALYNQIDRFKNPAGLHTNAIYGFHLMLDHMMKRVEPTHV
LVAFDAGKTTFRTELFADYKAGRAKTPEEFREQLPYIREMLTALGVSYYDLENYEADDII
GTLDKLAENEDEYDVTIVSGDKDLIQLTDSNTTVEISKRGVAEFEEFTPAYLMEKMGLTP
KQFIDLKALMGDKSDNIPGVTKIGEKTGLRLLHEHGSLEAIYEHIDSFKSSKMKENLIKD
KEKAFLSKTLATIDTQAPITITLDDIDYSGPQFDALAKFYDEMDFRQFRTQLGSSPKAEN
FEVSYTEVTELKPDMFAPDQFFYFEILNDNYHTQEMIGLAWGDDQAIYATTDTSLLTHDL
FKEALSKPIKTYDFKRSKVLLSHLGIDLPTASFDSRLAKYLLSTVENNNISTIARLYTDL
PLETDDDVYGKGAKRAIPEKDVLLSHLAKKISVLLASEGPMRQKLSTNDQLNLLFDMELP
LANVLAKMEIAGISVRKETLQDMERANEIELQALTQEIYDLAGEAFNINSPKQLGVILFE
KLGLPLSATKKTKTGYSTAVDVLERLAHRSPIVAKILEYRQIAKLQSTYIIGLQDSISFD
GKIHTRYLQDLTQTGRLSSVDPNLQNIPVRLEQGRLIRKAFVPEWKESVLLSSDYSQIEL
RVLAHISGDEHLIAAFKEGADIHTSTAMRVFGIERPEDVTPNDRRNAKAVNFGVVYGISD
FGLANNLGISRKAAKNYIETYFERYPGIKNYMDRVVREARDKGYVETLFHRRRELPDINS
RNFNIRSFAERTAINSPIQGSAADILKVAMIHLDQALKEGNYQSRMLLQVHDEIVLEVPN
AELEAIQKLVKKTMESAIELSVPLVADENAGQTWYEAK
NT seq 2637 nt   +upstreamnt  +downstreamnt
atgacaaacaagaaaaaattattattgattgacggttcttccgttgcttatcgtgctttc
tttgcactttataatcaaattgaccgctttaaaaatcctgctggtttacacaccaatgcc
atttatggctttcatttaatgctggatcatatgatgaaaagggtggagccgacgcatgtt
ttagtggcttttgatgctgggaaaacgacttttcgaacagaactgtttgcagattataag
gcaggccgtgctaaaacgccagaagaatttcgtgagcagctgccctatattagagagatg
ctaacagctttaggtgtttcctattatgatttggaaaattatgaagctgatgacattatt
ggaacccttgataaattagccgaaaatgaggatgaatatgatgttactattgtcagcggt
gataaggacctcattcagctgactgatagtaatacgactgttgagatttccaaaaggggc
gttgctgagtttgaagaatttacaccagcctatctcatggaaaaaatgggactgacgcct
aagcaatttattgatctcaaggctctcatgggggacaagtctgataatatcccaggtgtc
accaaaattggtgagaagacaggcttgaggctgctgcatgagcatggtagtttagaagct
atttatgagcatattgatagctttaaaagctctaagatgaaggaaaatcttatcaaggat
aaagaaaaggcctttctttctaagacgctggcaaccattgatacgcaagcgccgattacc
atcactttagacgatattgattactctggtcctcagtttgacgcactggctaagttttat
gatgaaatggacttcagacaatttcgaacacaacttggcagttcacctaaagccgaaaat
tttgaagtgagttatacagaagtgactgaactcaagcccgatatgtttgcgcctgatcaa
ttcttttattttgaaattttgaatgataattatcatacccaagagatgatcggtttggct
tggggagatgaccaagcgatttatgcgacaactgataccagtttgctgacgcatgatttg
tttaaagaagccttatcaaaacctattaaaacttatgattttaagcgcagtaaggtcttg
ctgagtcatttgggcattgatctgccgacagctagtttcgatagtcgtttggccaaatat
ttgctgtcaactgttgaaaataataacatttcgaccattgccagactttacacagattta
cctttggaaacagacgatgatgtgtatggcaaaggagctaaacgtgctatcccagaaaaa
gatgttctgcttagccatttagctaaaaaaatcagtgtcttgcttgctagtgaaggaccg
atgcggcagaaactgtctactaatgaccaactgaacttgctttttgatatggaattaccg
ctggcaaatgtgttggctaaaatggaaattgcaggtatttcggttagaaaagaaacgctg
caggacatggagcgggccaatgagattgaactgcaggctctgactcaggagatctatgac
ttagctggtgaggcgttcaatatcaattctccaaaacaattgggggttatcctctttgaa
aaattgggtctacctttgtcagccactaaaaaaacgaaaacaggttattcaacagctgtt
gatgttttggagcgtctggctcatcgttcaccaatcgttgctaaaattttagaatatcgc
caaattgcgaaattacaatccacctatatcattggcttgcaagattccatttcctttgat
ggcaagattcacacccgttatttgcaagatttaacgcagactggtcgcttatccagcgtt
gatcctaatttacaaaatattcctgtgcgtttggaacagggacgtcttattcgcaaggcc
tttgtgcctgaatggaaagagagcgtcctgctcagttcagattattcacaaattgaattg
cgtgtgctggctcatatttcaggcgatgaacatttaattgctgcttttaaggaaggagca
gacattcacacctctacagccatgcgtgtctttggtattgaaagaccagaagacgtcact
cctaatgaccgtcgcaatgccaaggctgttaactttggtgtggtttatggcatttccgat
tttggtctggctaataatttgggtattagtcgcaaagccgctaagaattacattgaaacc
tattttgaacgttatccgggaattaaaaattatatggatagagtggtacgtgaagcgcgt
gataagggttatgttgaaacgctctttcatcgccgccgtgaattaccggatatcaattca
cgcaattttaatattcggtcttttgcggagcgaacagctattaactcgcctattcaaggg
agtgccgccgatattctcaaagtggccatgattcatctcgaccaagccttgaaagaagga
aattatcaatcgcggatgctcctgcaggtgcatgacgaaattgtccttgaggtgccaaat
gctgaacttgaagcgatccaaaagttggtcaagaaaaccatggaatctgctattgagctt
tctgtaccgcttgtggcagatgaaaatgcagggcagacttggtatgaagcaaagtaa

DBGET integrated database retrieval system