KEGG   Streptococcus troglodytae: SRT_20430
Entry
SRT_20430         CDS       T06912                                 

Name
(GenBank) 3-methyladenine DNA glycosylase
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
strg  Streptococcus troglodytae
Pathway
strg03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:strg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SRT_20430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:strg03400]
    SRT_20430
Enzymes [BR:strg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     SRT_20430
DNA repair and recombination proteins [BR:strg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SRT_20430
 Prokaryotic type
     SRT_20430
SSDB
Motif
Pfam: Pur_DNA_glyco
Other DBs
NCBI-ProteinID: BAQ25304
UniProt: A0A1L7LM74
LinkDB
Position
complement(2055801..2056379)
AA seq 192 aa
MLSKEFKQVMETDTIATAKALLGMQLCLDGKPLGRIVETEAYLGSKDSACHSANDRRTPK
NEAMYLAAGHWYVYQIYGHQMLNLVTKPQNVAEAVLIRALETTDGHLLANGPGKLTKFAG
IDKSFNGDSLQDSRLTLQEDLSPQRIEKRSRIGVTCTDEWKDAMLCFYVTGNQHVSKIAK
KSLLTDKETWKF
NT seq 579 nt   +upstreamnt  +downstreamnt
atgctatcaaaagaatttaaacaagttatggaaacagataccattgcaacagccaaggct
ttattaggaatgcaattgtgcttggatggtaagcctttagggagaattgttgaaacagaa
gcctatttagggagcaaagacagtgcttgtcatagcgcaaatgatcgcagaactcctaaa
aatgaagccatgtatttagcggcagggcactggtatgtttaccaaatttatgggcatcag
atgctgaatttagtgactaagcctcaaaatgtagcagaagccgttttgattcgagccctt
gaaacaactgacggtcatttactggccaatggacctggtaaattgactaaatttgcgggc
attgataaaagctttaatggtgattctttacaagactctagactgactttacaagaggat
ttatcaccacagcgtattgaaaaacgttctcgcattggtgtgacttgtactgatgagtgg
aaagatgcgatgctttgtttttatgttacaggaaatcaacatgtttcaaagatagctaaa
aaaagcctcttaacggataaagagacttggaaattttaa

DBGET integrated database retrieval system