Streptacidiphilus sp. P02-A3a: GXP74_05500 Help Entry GXP74_05500       CDS       T08580                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism strh  Streptacidiphilus sp. P02-A3a Brite KEGG Orthology (KO) [BR:strh00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     GXP74_05500 Enzymes [BR:strh01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      GXP74_05500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like Thioredoxin Motif Other DBs NCBI-ProteinID:  QMU67766 LinkDB All DBs Position complement(1191121..1191375) Genome browser AA seq 84 aa AA seqDB search MSAEITMYSTTWCGYCNRLKKQLDREGIGYTEINIELDPASADFVEQVNNGNQVVPTVLV VPVGGERVVMTNPSLAQVKQAAGV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtccgccgagatcacgatgtacagcaccacctggtgcggctactgcaaccgactcaag aagcagctggaccgcgagggtatcggctacaccgagatcaacatcgagctcgacccggcg tccgccgacttcgtggagcaggtcaacaacggcaaccaggtcgtcccaacggtgctggtg gtgcccgtcggcggcgagcgggtggtgatgaccaaccccagcctggcccaggtcaagcag gccgccggggtctga

DBGET integrated database retrieval system