Streptomyces sp. JH002: H7827_20255 Help Entry H7827_20255       CDS       T11115                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism strj  Streptomyces sp. JH002 Pathway strj00998   Biosynthesis of various antibiotics strj01100   Metabolic pathways strj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H7827_20255    00074 Mycolic acid biosynthesis     H7827_20255   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H7827_20255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XVJ77735 LinkDB All DBs Position 4433149..4433385 Genome browser AA seq 78 aa AA seqDB search MVCELMAKKLGGKADQHTLNADTEFETVGLSSLQIADIVYAIEDEVGIEFDPGQAANVKT VGDLVELARATKLGSVEA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggtctgcgaactgatggcgaagaagctcggcggcaaggcggatcagcacacgctcaac gccgataccgaattcgagaccgtcggtctttccagccttcagatcgccgacatcgtctat gccatcgaggacgaggtcggcatcgaattcgaccccggccaggcggccaatgtgaagacc gtcggcgacctggtcgagctggcccgcgccaccaagctcggcagcgtcgaggcatga

DBGET integrated database retrieval system