Streptomyces sp. RLB1-33: HEP84_26750 Help Entry HEP84_26750       CDS       T10398                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism strl  Streptomyces sp. RLB1-33 Pathway strl00253   Tetracycline biosynthesis strl01056   Biosynthesis of type II polyketide backbone strl01100   Metabolic pathways strl01110   Biosynthesis of secondary metabolites Brite Lipid biosynthesis proteins [BR:strl01004]  Polyketide synthase   Component type    HEP84_26750 Polyketide biosynthesis proteins [BR:strl01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      HEP84_26750     Nonaketide PKS      HEP84_26750     Decaketide PKS      HEP84_26750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QIY72209 UniProt:  A0A6H1L8J0 LinkDB All DBs Position 5912930..5913205 Genome browser AA seq 91 aa AA seqDB search MSTSEFTLDDLRRILQEGAGVDEGVDLDGDILDEPFEVLGYESLALLETGSRIEREYGIV LDEDLLTDADTPRALIEAVNQQFGADEPAAA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgtccacttcggaattcaccctggacgacctgcgccgcatcctccaggagggcgccggc gtcgacgagggcgtcgacctcgacggcgacatcctcgacgagccgttcgaagtcctcggc tacgagtcgctggcgctcctggagaccggcagccgtatagagcgcgagtacgggatcgtc ctcgacgaggacctgctgaccgacgccgacaccccgcgcgccctcatcgaggccgtgaac cagcagttcggcgccgacgagcccgccgccgcctga

DBGET integrated database retrieval system