Streptomyces sp. Mg1: M444_02740 Help Entry M444_02740        CDS       T03958                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism strm  Streptomyces sp. Mg1 Pathway strm00362   Benzoate degradation strm00621   Dioxin degradation strm00622   Xylene degradation strm01100   Metabolic pathways strm01120   Microbial metabolism in diverse environments strm01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:strm00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     M444_02740    00622 Xylene degradation     M444_02740    00621 Dioxin degradation     M444_02740 Enzymes [BR:strm01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      M444_02740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_3 Motif Other DBs NCBI-ProteinID:  AKL64511 UniProt:  B4UXU2 LinkDB All DBs Position 1:597757..597981 Genome browser AA seq 74 aa AA seqDB search MPFANFKVPAGTLTAEQKEQIITRTTDLYAEIFGDRARATTLVLVEEVADAGWGIGGGVL TLAKVGHVGQVAQN NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgccattcgcgaacttcaaggtccccgccggcaccctcaccgcagagcagaaggagcag atcatcacgcgtaccaccgacctctacgccgaaatcttcggcgaccgcgcccgggccacc accctcgtactggtggaagaggtcgccgacgccggatggggcatcggcggtggagtcctg acgctcgccaaggtcgggcacgtcgggcaggtcgcgcagaactga

DBGET integrated database retrieval system