Streptomyces sp. Mg1: M444_12040 Help Entry M444_12040        CDS       T03958                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism strm  Streptomyces sp. Mg1 Pathway strm00998   Biosynthesis of various antibiotics strm01100   Metabolic pathways strm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M444_12040    00074 Mycolic acid biosynthesis     M444_12040   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M444_12040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AKL66019 UniProt:  B4V439 LinkDB All DBs Position 1:2836978..2837226 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVEGLAEIVNEIAGIPTEDVEIHKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgtcgagggtctcgcggagatcgtcaacgagatcgcc ggcatccccaccgaggacgtcgagatccacaagtccttcacggacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccc gacgaggacgtcaagaacctcaagacggtcggcgacgccgctgactacatcctgaagcac caggcctga

DBGET integrated database retrieval system