Streptomyces sp. Mg1: M444_13980 Help Entry M444_13980        CDS       T03958                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism strm  Streptomyces sp. Mg1 Brite KEGG Orthology (KO) [BR:strm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:strm03032]     M444_13980    03036 Chromosome and associated proteins [BR:strm03036]     M444_13980    03400 DNA repair and recombination proteins [BR:strm03400]     M444_13980 DNA replication proteins [BR:strm03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     M444_13980 Chromosome and associated proteins [BR:strm03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     M444_13980 DNA repair and recombination proteins [BR:strm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       M444_13980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG A_thal_3526 Major_capside Motif Other DBs NCBI-ProteinID:  AKL66324 UniProt:  B4VEQ6 LinkDB All DBs Position 1:complement(3278807..3279088) Genome browser AA seq 93 aa AA seqDB search MNRSELVAALSERAEVTRKDADAVLAALAETIGEVVAKGDEKVTIPGFLTFERTHRAART ARNPQTGDPIQIPAGFSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgctctgtccgagcgcgccgaggtgacccgcaaggac gccgacgccgttctggccgccctcgccgagaccatcggtgaggtcgtcgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gcgcgcaacccgcagaccggcgaccccatccagatcccggccggcttcagcgtgaaggtc tccgcgggctccaagctcaaggaagccgccaagggcaagtag

DBGET integrated database retrieval system