KEGG   Streptomyces sp. Mg1: M444_34475
Entry
M444_34475        CDS       T03958                                 
Name
(GenBank) acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm00290  Valine, leucine and isoleucine biosynthesis
strm00650  Butanoate metabolism
strm00660  C5-Branched dibasic acid metabolism
strm00770  Pantothenate and CoA biosynthesis
strm01100  Metabolic pathways
strm01110  Biosynthesis of secondary metabolites
strm01210  2-Oxocarboxylic acid metabolism
strm01230  Biosynthesis of amino acids
Module
strm_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
strm_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:strm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M444_34475
   00660 C5-Branched dibasic acid metabolism
    M444_34475
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    M444_34475
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    M444_34475
Enzymes [BR:strm01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     M444_34475
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_M TPP_enzyme_N Glyco_transf_4 DUF4230
Other DBs
NCBI-ProteinID: AKL70548
LinkDB
Position
pSMg1-1:complement(10287..11972)
AA seq 561 aa
MSDAEHRKQTPDGAAELLVRCLENEGVEVVFGVPGEENIRFTNALARSEKIRYVLTRHEQ
AASFMAEMHGRLTGSAGVMSATLGPGAINLMLGVADAMTNSTPVVAITAQVGKERNYKES
HQFVDLVSMFAPVTKWSAQVPATQAIPEMVRRAFKTAESERPGAVYLAVPEDVDAATDGS
DLRPLRRNVVQPEAPSPKQIKRAVELLREARRPVILAGHGAARGGAAESLTAFATALDVS
TATTFHGKGVLPDDHPCATGTFGFMRRDYTNFGFEEADVVIAVGYELQEFDPSRINPDGD
KKIIHIHRVPAEVDDSYSVDVGIIGDISASLDALATELDGLRWTIDDEDTMATRALLAKE
LEQGATDERYPLAPQRVIADTRAALGRDDIVLVDTGALKMWMARLYPTYAPNTCLISNGL
STMGFSLPGALAVQLARPQTKVLAAVGDGSFLMHSQEIETAVRENIPLTVLIWEDNGYGL
IKWKMDLELGENSNTDFGNPDIVQYARSFGAKGYHIESAGDLLPTLREALADPGVSIINC
PVDYAENMNLIKHLGHLDSAL
NT seq 1686 nt   +upstreamnt  +downstreamnt
gtgagcgacgccgagcaccggaagcagacccccgacggagcggccgaactcctggttcgc
tgcctggagaacgagggcgtcgaggtggtgttcggcgtgcccggcgaggagaacatccgt
ttcaccaacgccctcgcccgctcggagaagatccgctacgtcctcacccggcacgagcag
gccgcgtctttcatggcggagatgcacggccggctcaccggctcggcgggtgtgatgtcc
gcgacgctggggcccggcgcgatcaacctgatgctgggcgtcgccgacgctatgacgaac
agcacgcccgtcgtcgcaatcaccgcgcaggtcggcaaggagcgcaactacaaggagtcc
caccagttcgtggacctggtgagcatgttcgccccggtcacgaagtggtcggcgcaggtc
ccggccacccaggccatccccgagatggtgcggcgcgcgttcaagaccgcggagtccgag
cggcccggcgccgtctatctcgccgtgcccgaggacgtcgacgcggcgacggacggctcg
gacctgcgcccgctgcgcaggaacgtcgtgcagcccgaggcaccgtctccgaagcagatc
aagcgagcggtggagctgctgcgggaggcccgccggccggtgatcctcgccggacacggc
gcggcgcgcggcggcgccgcagagtcgctgacggcgttcgccaccgcactcgacgtgtcg
acggcgacgaccttccacggcaagggcgtcctgcccgacgaccacccgtgcgcgaccggc
acgttcggcttcatgcggcgcgactacaccaacttcgggttcgaggaggccgacgtcgtc
atcgccgtcggctacgagctgcaggagttcgacccgtcccggataaacccggacggtgac
aagaagatcatccacatccaccgcgtcccggcggaggtggacgacagctactcggtcgac
gtcggcattatcggcgacatttcggcctccctcgacgccctcgccaccgaactcgacggc
ctgcgctggaccatcgacgacgaggacaccatggccacccgcgcgctgctggccaaggaa
ctcgagcagggcgccacggacgagcgctacccgctcgccccgcagcgcgtcatcgccgac
acccgcgccgcgctcggtcgcgacgacatcgtgctggtcgacaccggcgcgctgaagatg
tggatggcccggctctatccgacgtacgcgccgaacacctgcctcatctccaacggcttg
tccaccatgggcttctcgctgcccggcgcgctcgcggttcagctcgccaggccgcagacg
aaggtgctggcggcggtcggcgacggctcgttcctcatgcactcccaggagatcgagacg
gcggtccgcgagaacattccactgaccgtgctgatctgggaggacaacggctacgggctc
atcaagtggaagatggacctggagctcggggaaaactccaacaccgacttcggcaacccg
gacatcgtccagtacgcccgcagcttcggcgcgaagggctaccacatcgagtccgctggg
gacctgctgccgacgctccgtgaggcactggcggacccgggcgtgtcgatcatcaactgc
ccggtggactacgccgagaacatgaacctcatcaagcacctcgggcacctcgactcggcg
ctctga

DBGET integrated database retrieval system