Streptomyces sp. MOE7: STRMOE7_03910 Help Entry STRMOE7_03910     CDS       T05374                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism stro  Streptomyces sp. MOE7 Pathway stro03060   Protein export stro03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:stro00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     STRMOE7_03910  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     STRMOE7_03910  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:stro02044]     STRMOE7_03910 Secretion system [BR:stro02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    STRMOE7_03910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ARH89577 UniProt:  A0A1W5XI87 LinkDB All DBs Position 856093..856350 Genome browser AA seq 85 aa AA seqDB search MLRNGLEPWHLLIVALVVILLFGSKRLPDTARALGKSLRILKSEAKAMASDDAPPSATFT TGPQPRRAPEPPPHPRTESGPDPVR NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgttgcgcaacggactggagccctggcacctgctgatcgtggcgctggtggtgatcctg ctcttcggctccaagaggctgccggacaccgcacgcgcgctgggcaagtcgctgcggatc ctcaagagcgaggcgaaggcgatggcctccgacgacgcgccgccgagcgccaccttcacc accggcccgcaaccccgtcgcgcgcccgagccgccgccgcatccccgtacggagagcggc ccggatcccgtgcggtga

DBGET integrated database retrieval system