KEGG   Streptomyces sp. MOE7: STRMOE7_13310
Entry
STRMOE7_13310     CDS       T05374                                 
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00430  Taurine and hypotaurine metabolism
stro00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    STRMOE7_13310
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    STRMOE7_13310
Enzymes [BR:stro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     STRMOE7_13310
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: ARH95258
LinkDB
Position
2985646..2986551
AA seq 301 aa
MRAHRIPADGLYEGPRTLRRTPDGWEDRPYERFEVVPQAATIGAEIRGLDLSRPLSGGLR
AELNRALLEWKVLFFRGQHLTSESQREFAANWGELETNPLLAQGDSRDVVRFDKTAGGVP
TFENVWHTDVTFRERPALGAVLQLREVPPAGGDTMWADMAAAYDNLPSEIRVAIDGARAV
HDYLPGFARFYSPAQLAPFQEQFPPVEHPVVRRHPETGRRMLFVNASFTTRIVGWDETAG
DRMLRLLFQQAHVPEFQVRWRWQAGDLAFWDNRATQHYAVNDYGTARRVAERVAIAGDRP
Y
NT seq 906 nt   +upstreamnt  +downstreamnt
ctgcgcgcgcaccgcatcccggcagacgggctgtacgagggaccacggacgctgcgccgt
acgcccgacggatgggaggaccggccgtacgagcgcttcgaggtcgtgccgcaggctgcg
acgatcggggccgagatccgtgggctggacctgtcccgaccgctgtccggggggctgcgc
gcggagctgaaccgggcgctgctggagtggaaggtactgttcttccgcggccagcacctt
acttccgagtcacaacgtgaattcgccgccaattggggggagttggagaccaacccactg
ctcgcacagggtgattcccgggacgtggtgcggttcgacaagacggccggcggggtgccc
acgttcgagaacgtatggcacacggacgtcacgttccgggagcggccggcgctcggtgcg
gtgttgcagttgcgcgaggtgccgcccgccggcggggacaccatgtgggccgatatggcc
gcggcgtacgacaatttgccttcggaaatcagggtcgcgatcgacggggcgcgggcggtg
cacgactatctcccgggcttcgcccgcttctactcccccgcacaactcgcgccattccag
gagcagttcccgcccgtcgagcatccggtggtgcgccggcacccggagaccgggcggcgg
atgctgttcgtcaacgcgtccttcaccacgcggatcgtgggctgggacgagacggccggc
gaccggatgctacggctgctgttccagcaggcgcacgtaccggagttccaggtgcggtgg
cgctggcaggccggcgatctcgcgttctgggacaaccgcgccacccagcactacgcggtg
aacgactacgggaccgcgcgccgggtcgccgaacgggtcgccatcgcgggcgaccgcccg
tactga

DBGET integrated database retrieval system