Streptomyces sp. MOE7: STRMOE7_33205 Help Entry STRMOE7_33205     CDS       T05374                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stro  Streptomyces sp. MOE7 Pathway stro00998   Biosynthesis of various antibiotics stro01100   Metabolic pathways stro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     STRMOE7_33205    00074 Mycolic acid biosynthesis     STRMOE7_33205   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     STRMOE7_33205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding HTS Motif Other DBs NCBI-ProteinID:  ARH94351 LinkDB All DBs Position complement(7572430..7572666) Genome browser AA seq 78 aa AA seqDB search MSDAVFETVRSCAVEVLQVAPEEVTMEADFTDHLGATSLTLVELVMAIEEACSVDLPDDG VESVRTVRDACELVRARI NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgcagtgttcgagacagtccggtcgtgcgcggtggaagtgctgcaggtcgcg ccggaagaagtgaccatggaggcggacttcacggatcacctgggggccaccagcctgacc ctcgtggagctggtcatggcgatcgaggaagcctgttccgtcgatctgcccgatgacggc gtcgagtccgtacggaccgtccgcgacgcctgcgagttagtgcgcgcgcggatatga

DBGET integrated database retrieval system