Streptomyces sp. MOE7: STRMOE7_34415 Help Entry STRMOE7_34415     CDS       T05374                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stro  Streptomyces sp. MOE7 Pathway stro00998   Biosynthesis of various antibiotics stro01100   Metabolic pathways stro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     STRMOE7_34415    00074 Mycolic acid biosynthesis     STRMOE7_34415   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     STRMOE7_34415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF4351 Motif Other DBs NCBI-ProteinID:  ARH94549 LinkDB All DBs Position complement(7872167..7872400) Genome browser AA seq 77 aa AA seqDB search MNAAEVVNALLVQRFGVSSGDVTDETPLRSLRIDSLALEELRVLIEDQLDIDLEDVPLTS RDTVGQLVAAVDGMVPA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtgaatgcggcagaagttgtcaacgccttgctggtccaacgcttcggggtttcgtcgggc gacgtcaccgatgagaccccgctgcgcagcctgcgcatcgactccctcgcgctggaagaa ctccgtgtactgatcgaggaccagctggacatcgacctcgaggacgtgccgctgacctcg cgcgacaccgtgggccagctggtggcggccgtcgacggcatggttccggcgtga

DBGET integrated database retrieval system