Streptomyces sp. PAMC 26508: F750_0147 Help Entry F750_0147         CDS       T02619                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism strp  Streptomyces sp. PAMC 26508 Pathway strp00362   Benzoate degradation strp00622   Xylene degradation strp01100   Metabolic pathways strp01120   Microbial metabolism in diverse environments strp01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:strp00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     F750_0147    00622 Xylene degradation     F750_0147    00621 Dioxin degradation     F750_0147 Enzymes [BR:strp01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      F750_0147 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_3 YpM Motif Other DBs NCBI-ProteinID:  AGJ52658 LinkDB All DBs Position complement(140319..140549) Genome browser AA seq 76 aa AA seqDB search MPFANFKVPEKTLTPKQKEQIVTRTTELYVEIYGERARDNTMILVEEVTDGGWGISGNVL TLAMLGEATPTHTSDA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgcctttcgcgaacttcaaggtccccgagaagaccctcacccccaagcagaaggagcag atcgtcacccgcaccaccgagctgtacgtcgagatctacggcgaacgcgcccgtgacaac accatgattctggtcgaagaggtcaccgacggcggctggggcatctccggcaacgtgctg acccttgccatgctcggcgaggcgacaccgacccacaccagcgacgcctga

DBGET integrated database retrieval system