Streptomyces sp. PAMC 26508: F750_1307 Help Entry F750_1307         CDS       T02619                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism strp  Streptomyces sp. PAMC 26508 Pathway strp00253   Tetracycline biosynthesis strp01056   Biosynthesis of type II polyketide backbone strp01100   Metabolic pathways strp01110   Biosynthesis of secondary metabolites Module strp_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:strp00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     F750_1307    00253 Tetracycline biosynthesis     F750_1307  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:strp01004]     F750_1307    01008 Polyketide biosynthesis proteins [BR:strp01008]     F750_1307 Lipid biosynthesis proteins [BR:strp01004]  Polyketide synthase   Component type    F750_1307 Polyketide biosynthesis proteins [BR:strp01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      F750_1307     Nonaketide PKS      F750_1307     Decaketide PKS      F750_1307 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGJ53815 LinkDB All DBs Position 1325360..1325605 Genome browser AA seq 81 aa AA seqDB search MKGFTLADLKRVMRECAGEDENVDLDGDILDAPFENLGYDSLALLETATRIERELGVRMP EEVLSGARTPRLLLDAVASAR NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaagggcttcaccctcgccgacctgaagcgcgtgatgcgggaatgcgccggggaggac gagaacgtcgacctggacggcgacatcctggacgcgccgttcgagaacctcggctacgac tcgctcgcgctgctcgagacggcgacccggatcgagcgggagctcggtgtgcgcatgccg gaggaggtgctgagcggggccaggacgccccggctcctgctggacgccgtggcatccgcc cgctga

DBGET integrated database retrieval system