Streptomyces sp. PAMC 26508: F750_2263 Help Entry F750_2263         CDS       T02619                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism strp  Streptomyces sp. PAMC 26508 Pathway strp00998   Biosynthesis of various antibiotics strp01100   Metabolic pathways strp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F750_2263    00074 Mycolic acid biosynthesis     F750_2263   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F750_2263 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AGJ54757 LinkDB All DBs Position 2335558..2335806 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVTGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcaccggtctcgccgagatcgtcaacgagatcgcc ggtatcccggtcgaggacgtccagctggacaagtccttcaccgacgacttggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccc gacgaggacgtcaagaacctcaagacggtcggcgacgccgccgactacatcctgaagcac cagggctga

DBGET integrated database retrieval system