KEGG   Streptomyces sp. PAMC 26508: F750_6322
Entry
F750_6322         CDS       T02619                                 

Name
(GenBank) agmatinase
  KO
K12676  proclavaminate amidinohydrolase [EC:3.5.3.22]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp00331  Clavulanic acid biosynthesis
strp01100  Metabolic pathways
strp01110  Biosynthesis of secondary metabolites
Module
strp_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:strp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    F750_6322
Enzymes [BR:strp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.22  proclavaminate amidinohydrolase
     F750_6322
SSDB
Motif
Pfam: Arginase
Other DBs
NCBI-ProteinID: AGJ58747
LinkDB
Position
complement(6740722..6741672)
AA seq 316 aa
MERVDTTISPRYAQIPTFMRLPHDPNPSGRDVVVIGAPYDGGTSYRPGARFGPRAIRNES
GLIHGVGIDRGPGTFELIDCVDGGDIDLTPFNMHIAMETAHRHLRDLLQDNAAFLMLGGD
HSLTLAALRAVAEQHGPVAVVHLDAHSDTNPAFYGGEFHHGTPFRHGIDEGLIDPARTVQ
IGIRGHNPRPDSLDYARGKGVRVVTTDEFVETGVAGTHALIQELIGDRPVYVSVDVDVAD
PAFAPGTGTPAPGGLSSREVLALLRCVGELRPVGFDVMEVSPLYDHAGITSVLATEIGAE
LLYQYARAHIKGRNDA
NT seq 951 nt   +upstreamnt  +downstreamnt
gtggaacgtgtcgacaccacgatctcgccccgttacgcgcagatccccaccttcatgcgt
ctgccgcacgacccgaatcccagcggacgcgacgtcgtggtcatcggtgccccctacgac
ggcggcacgagctaccggccgggtgcccgtttcggcccccgcgccatccgcaacgagtcc
ggactgatccacggggtcggcatcgaccgggggcccggcaccttcgaactcatcgactgc
gtggacggcggggacatcgacctcaccccgttcaacatgcacatcgccatggagacggcc
caccgccatctgcgcgacctcctccaggacaacgccgccttcctgatgctcggcggcgac
cactcgctcaccctggccgccctgcgtgccgtggccgagcagcacgggcccgtcgccgtg
gtccacctggacgcgcattccgacaccaaccccgctttctacggcggtgagttccaccac
gggactcccttccggcacgggatcgacgaaggcctcatcgaccccgcccgcacggtgcag
atcggaatcaggggccacaacccccggcccgactcgctggactacgcacggggcaagggg
gtgcgtgtcgtcacgacggacgagttcgtggagaccggtgtcgccgggacccacgcactc
atccaggagctcatcggcgaccgccccgtctacgtgtcggtcgacgtcgacgtcgccgac
ccggccttcgccccgggcaccggcacccccgcgcccggcgggctctcctcccgcgaggtg
ctggccctgctgcgctgcgtgggtgagctgcgtccggtcggtttcgacgtcatggaggtc
tcgcccctctacgaccacgccgggatcacctccgtcctggcgaccgagataggcgcggag
ctgctctaccagtacgcccgcgctcacatcaaaggaaggaacgacgcgtga

DBGET integrated database retrieval system