KEGG   Streptomyces sp. 11-1-2: CGL27_14250
Entry
CGL27_14250       CDS       T11393                                 
Symbol
ftsW
Name
(GenBank) putative lipid II flippase FtsW
  KO
K03588  peptidoglycan glycosyltransferase [EC:2.4.99.28]
Organism
strq  Streptomyces sp. 11-1-2
Pathway
strq00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:strq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CGL27_14250 (ftsW)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:strq01003]
    CGL27_14250 (ftsW)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:strq01011]
    CGL27_14250 (ftsW)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:strq03036]
    CGL27_14250 (ftsW)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:strq02000]
    CGL27_14250 (ftsW)
Enzymes [BR:strq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.28  peptidoglycan glycosyltransferase
     CGL27_14250 (ftsW)
Glycosyltransferases [BR:strq01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   CGL27_14250 (ftsW)
Peptidoglycan biosynthesis and degradation proteins [BR:strq01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase
   CGL27_14250 (ftsW)
Chromosome and associated proteins [BR:strq03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    CGL27_14250 (ftsW)
Transporters [BR:strq02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   CGL27_14250 (ftsW)
SSDB
Other DBs
NCBI-ProteinID: ASQ94079
LinkDB
Position
complement(3437250..3438506)
AA seq 418 aa
MDALRGLQQRLRRAWDRPLTAYYLLLGGSLLILVLGLVMVYSASQIKALQSGLSPSYFFR
KQLFAAALGGALMLLAVRMPIKLHRAFAYPLLAVSVFLMCLVQVPGMGIAVNGNQNWISF
GGPFLLQPSEFGKLALVLWGADLLARKQDKRLLAQWKHLLVPLVPATGMLLGLIMLGGDM
GTAIILTAILFGLLWLAGAPTRLFVGVLAFAGAIGMLLIKTSANRMSRLACIGATEPGAH
DQCWQAVHGIYALANGGWFGSGLGASMEKWGELPEPHTDFIFAITGEELGLAGTLSVLVL
FAALGYAGIRVAGRTEDPFVRYAAGGVTTWITAQAVVNIGAVLGLLPIAGVPLPLFSYGG
SALLPTMFAVGLLIAFARAEPGARAALAMRQPALRKKLARVRRKTMRRPVKRRPSGER
NT seq 1257 nt   +upstreamnt  +downstreamnt
ttggacgcgctgcgcgggctgcagcagcgcctccggagggcctgggaccggccgctgacc
gcgtactacctactgctcggcggctcgctgctgatcctggtgctcggtctggtgatggtc
tactccgcctcccagatcaaggcgctgcagtccgggctctcaccgtcgtacttcttccgc
aaacagcttttcgccgccgcgctgggcggcgcgctgatgctgctcgccgtgcggatgccc
atcaaactgcaccgcgccttcgcctatccgctgctcgcggtctcggtcttcctgatgtgt
ctggtgcaggtcccgggcatgggcatcgcggtcaacggcaatcagaactggatctccttc
ggcggcccgttcctgctccagcccagtgagttcggtaagctggcactcgtcctgtggggc
gccgatcttctcgcccgcaaacaggacaagcggctgctggcccagtggaagcacctgctg
gtcccgctggtgcccgcgaccggcatgctgctcggcctgatcatgctgggcggggacatg
ggcaccgcgatcattctcacggcgatccttttcggcctgctttggctggcgggcgcccct
acccggctcttcgtgggcgtcctcgccttcgccggggccatcggcatgctgctcatcaag
accagcgccaaccggatgtcccggctcgcctgtatcggcgccaccgagcccggtgcgcac
gatcagtgctggcaggctgtccacgggatctacgcgctcgccaacggcggctggttcgga
tccggactcggggcgagtatggagaaatggggcgaactaccggaaccgcatactgacttc
atcttcgccattaccggggaggaactcggtctggcggggacgctgtcggttctcgttctc
ttcgcggctctaggctatgcgggtatccgcgtggccggacgcacggaggaccccttcgtg
aggtacgccgcgggaggcgtgaccacctggatcacggcccaggccgtggtcaatatcggt
gcggtgctcggtctgctgccgatcgccggggttccgctcccgctgttctcctacggaggg
tccgccctgctgccgaccatgttcgccgtcggcctgctgatcgccttcgcacgggctgag
cccggtgcgcgagcggcgctggccatgcggcagcctgctttgcggaagaagctggctcgg
gtgagacggaagacgatgcgacggcccgtcaagaggcggccgtccggagagcggtga

DBGET integrated database retrieval system