Streptomyces sp. SAT1: A8713_00410 Help Entry A8713_00410       CDS       T04706                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism strt  Streptomyces sp. SAT1 Pathway strt00261   Monobactam biosynthesis strt01100   Metabolic pathways strt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strt00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A8713_00410  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strt01008]     A8713_00410 Polyketide biosynthesis proteins [BR:strt01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A8713_00410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANH89781 UniProt:  A0A1A9IT15 LinkDB All DBs Position 91622..91831 Genome browser AA seq 69 aa AA seqDB search MAATNPFEDDDARYLVLVNDENQHSLWPAFAEVPAGWTVVHGEDSRQECLSYVDEHWTDM RPASLAGRS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggccgccaccaaccccttcgaggacgacgacgcccgctacctggtcctggtcaacgac gagaaccagcactcgctgtggccggccttcgccgaggttcccgcgggctggaccgtggtc cacggcgaggactcccggcaggagtgcctctcctacgtggacgagcactggaccgacatg cgcccggcgagcctggccgggcggtcctga

DBGET integrated database retrieval system