Streptomyces sp. SAT1: A8713_19770 Help Entry A8713_19770       CDS       T04706                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism strt  Streptomyces sp. SAT1 Pathway strt00074   Mycolic acid biosynthesis strt00280   Valine, leucine and isoleucine degradation strt00630   Glyoxylate and dicarboxylate metabolism strt00640   Propanoate metabolism strt01100   Metabolic pathways strt01110   Biosynthesis of secondary metabolites strt01120   Microbial metabolism in diverse environments strt01200   Carbon metabolism Module strt_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:strt00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     A8713_19770    00640 Propanoate metabolism     A8713_19770   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     A8713_19770   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     A8713_19770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  ANH93127 UniProt:  A0A1A9J0N1 LinkDB All DBs Position complement(4552554..4552763) Genome browser AA seq 69 aa AA seqDB search MTIKVLRGNPTPEELAAALAVVRARAAAATAEPSGAPGPRDSWSDPSRIAAHRTPRPGPA AWARTYWPG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgacgatcaaggtcctacgaggcaacccgacccccgaggagctggccgccgcactggcg gtggtcagggcgcgcgccgcggcggccaccgccgagccgtccggcgcgcccggcccccgc gactcctggtccgacccgtcccggatcgccgcgcaccgcaccccgcggccgggcccggcc gcctgggcccgcacgtactggcccggctga

DBGET integrated database retrieval system