Salmo trutta (river trout): 115148215 Help Entry 115148215         CDS       T08542                                  Name (RefSeq) insulin   KO K04526   insulin Organism stru  Salmo trutta (river trout) Pathway stru04010   MAPK signaling pathway stru04068   FoxO signaling pathway stru04081   Hormone signaling stru04114   Oocyte meiosis stru04140   Autophagy - animal stru04150   mTOR signaling pathway stru04810   Regulation of actin cytoskeleton stru04910   Insulin signaling pathway stru04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:stru00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115148215    04068 FoxO signaling pathway     115148215    04150 mTOR signaling pathway     115148215   09133 Signaling molecules and interaction    04081 Hormone signaling     115148215  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115148215   09143 Cell growth and death    04114 Oocyte meiosis     115148215   09142 Cell motility    04810 Regulation of actin cytoskeleton     115148215  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     115148215    04914 Progesterone-mediated oocyte maturation     115148215  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:stru04052]     115148215 Cytokines and neuropeptides [BR:stru04052]  Neuropeptides   Unclassified    115148215 SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  115148215 NCBI-ProteinID:  XP_029546047 UniProt:  A0A673WF08 LinkDB All DBs Position 15:complement(10523266..10524499) Genome browser AA seq 105 aa AA seqDB search MAFWLQAASLLVLLALSPGADAAAAQHLCGSHLVDALYLVCGEKGFFYNPKRDVDPLIGF LSPKSAQENEEYPFKDQMEMMVKRGIVEQCCHKPCNIFDLQNYCN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccttctggctccaagctgcgtctctgctggtgctgctggcactctcccccggggca gacgctgcagctgcccagcacctgtgtggctctcacctggtggacgccctctatctggtg tgtggagagaaaggattcttttacaacccaaagagagatgtggatccccttatagggttc ctctctccaaaatcagcccaggagaatgaagagtaccccttcaaagaccagatggagatg atggtaaagagaggtattgtagagcagtgctgtcacaagccctgcaacatcttcgacctg cagaactactgcaactga

DBGET integrated database retrieval system