Salmo trutta (river trout): 115150254 Help Entry 115150254         CDS       T08542                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism stru  Salmo trutta (river trout) Pathway stru04081   Hormone signaling stru04144   Endocytosis stru04150   mTOR signaling pathway stru04270   Vascular smooth muscle contraction stru04310   Wnt signaling pathway stru04350   TGF-beta signaling pathway stru04510   Focal adhesion stru04520   Adherens junction stru04530   Tight junction stru04621   NOD-like receptor signaling pathway stru04625   C-type lectin receptor signaling pathway stru04810   Regulation of actin cytoskeleton stru05100   Bacterial invasion of epithelial cells stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     115150254    04350 TGF-beta signaling pathway     115150254    04150 mTOR signaling pathway     115150254   09133 Signaling molecules and interaction    04081 Hormone signaling     115150254  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115150254   09144 Cellular community - eukaryotes    04510 Focal adhesion     115150254    04520 Adherens junction     115150254    04530 Tight junction     115150254   09142 Cell motility    04810 Regulation of actin cytoskeleton     115150254  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     115150254    04625 C-type lectin receptor signaling pathway     115150254   09153 Circulatory system    04270 Vascular smooth muscle contraction     115150254  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115150254    05100 Bacterial invasion of epithelial cells     115150254  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:stru04131]     115150254   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115150254    04031 GTP-binding proteins [BR:stru04031]     115150254 Membrane trafficking [BR:stru04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     115150254 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115150254   Exosomal proteins of other body fluids (saliva and urine)    115150254   Exosomal proteins of colorectal cancer cells    115150254   Exosomal proteins of bladder cancer cells    115150254 GTP-binding proteins [BR:stru04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     115150254 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  115150254 NCBI-ProteinID:  XP_029549212 Ensembl:  ENSSTUG00000031565 UniProt:  A0A674BLZ1 LinkDB All DBs Position 16:19978517..19992250 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYMECSAKSKDGVREVFEMATRAALQ ARRGKQRHKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaatccgaaagaaactggtcatagtgggagacggagcctgcgggaagacgtgt ctgctcatcgttttcagtaaagatcagttccccgaggtctacgtgcccactgtctttgag aactatgtcgctgacattgaggtcgacagcaaacaggttgagttggcactatgggataca gcaggccaggaggactatgataggctccgtcccctctcttacccagatactgatgtcatc ctcatgtgtttctccattgatagccccgacagtttggaaaacatcccggagaagtggact ccagaagtcaaacacttctgccctaacgttcccattatcctagtgggcaacaaaaaggac ctgcgtaacgacgagcacacccgcagagagctagccaagatgaagcaggagcctgtgaag ccagaggaggggcgtgacatggcgaaccggatcagtgccttcggctacatggagtgctct gcaaagagcaaggatggggtgagggaagtgtttgagatggccacgagggcggcgctacag gcccggcgggggaagcagagacataaatgcctcctactgtaa

DBGET integrated database retrieval system