Salmo trutta (river trout): 115150535 Help Entry 115150535         CDS       T08542                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism stru  Salmo trutta (river trout) Pathway stru04810   Regulation of actin cytoskeleton stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     115150535  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115150535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  115150535 NCBI-ProteinID:  XP_029549801 Ensembl:  ENSSTUG00000021231 LinkDB All DBs Position 16:31170596..31175883 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccggtcaagaagatcccgtgcagagggagatccaccaagactgggcaaatcgagaa tacattgaggttatcacgagcagtatcaagaaaatagcagattttctaaattccttcgat atgtcctgccggtctcgtttggccaccctgaacgaaaagctgacagcattagagcggaga attgagtacattgaagcaagggtcacaaaaggagagacattgacctaa

DBGET integrated database retrieval system