Salmo trutta (river trout): 115150549 Help Entry 115150549         CDS       T08542                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism stru  Salmo trutta (river trout) Pathway stru04137   Mitophagy - animal stru04140   Autophagy - animal stru04144   Endocytosis stru04145   Phagosome stru04148   Efferocytosis stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115150549    04145 Phagosome     115150549    04140 Autophagy - animal     115150549    04137 Mitophagy - animal     115150549    04148 Efferocytosis     115150549  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115150549  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:stru04131]     115150549   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115150549    04031 GTP-binding proteins [BR:stru04031]     115150549 Membrane trafficking [BR:stru04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     115150549 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115150549   Exosomal proteins of other body fluids (saliva and urine)    115150549   Exosomal proteins of colorectal cancer cells    115150549   Exosomal proteins of bladder cancer cells    115150549 GTP-binding proteins [BR:stru04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     115150549 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 AAA_16 Septin AAA_22 AAA_7 AAA_24 NTPase_1 AAA_5 ATPase_2 NACHT ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  115150549 NCBI-ProteinID:  XP_029549827 Ensembl:  ENSSTUG00000027590 LinkDB All DBs Position 16:complement(32057571..32075711) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKDNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAEACSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtccaggaagaaagtgctcctgaaagtcatcatccttggggattctggagttggg aagacctccctgatgaaccagtatgtgaataggaagttcagtaaccagtacaaagccaca ataggagctgacttcctgaccaaggaggtgatggtggacgatcggctcgtcacaatgcag atctgggacacggcagggcaggagaggttccagtctctgggtgtggcgttctaccgcggg gcagactgctgtgtgctggtgtttgatgtgactgctcctaacacctttaagactctagac agctggagggacgagttcctgatccaggccagccccagagaccctgagaacttccccttt gtggtgctaggcaacaagatcgacctggagaacagacaggtgacgaccaagcgagctcag gcatggtgtcaaagtaaggacaacatcccctactttgagaccagtgctaaggaggccatc aacgtagagcaggccttccagaccatcgcacgcaatgccctaaaacaggagacagaggtg gagctgtataatgaattcccagaacccatcaagctggacaggaatgaccgagcaaagcct tcagcagaggcctgcagctgctga

DBGET integrated database retrieval system