Salmo trutta (river trout): 115152114 Help Entry 115152114         CDS       T08542                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism stru  Salmo trutta (river trout) Pathway stru04010   MAPK signaling pathway stru04012   ErbB signaling pathway stru04068   FoxO signaling pathway stru04137   Mitophagy - animal stru04140   Autophagy - animal stru04144   Endocytosis stru04150   mTOR signaling pathway stru04210   Apoptosis stru04218   Cellular senescence stru04370   VEGF signaling pathway stru04371   Apelin signaling pathway stru04510   Focal adhesion stru04540   Gap junction stru04625   C-type lectin receptor signaling pathway stru04810   Regulation of actin cytoskeleton stru04910   Insulin signaling pathway stru04912   GnRH signaling pathway stru04916   Melanogenesis stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115152114    04012 ErbB signaling pathway     115152114    04370 VEGF signaling pathway     115152114    04371 Apelin signaling pathway     115152114    04068 FoxO signaling pathway     115152114    04150 mTOR signaling pathway     115152114  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115152114    04140 Autophagy - animal     115152114    04137 Mitophagy - animal     115152114   09143 Cell growth and death    04210 Apoptosis     115152114    04218 Cellular senescence     115152114   09144 Cellular community - eukaryotes    04510 Focal adhesion     115152114    04540 Gap junction     115152114   09142 Cell motility    04810 Regulation of actin cytoskeleton     115152114  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115152114   09152 Endocrine system    04910 Insulin signaling pathway     115152114    04912 GnRH signaling pathway     115152114    04916 Melanogenesis     115152114  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115152114  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:stru04131]     115152114   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115152114    04031 GTP-binding proteins [BR:stru04031]     115152114 Membrane trafficking [BR:stru04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     115152114  Endocytosis   Macropinocytosis    Ras GTPases     115152114 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    115152114   Exosomal proteins of colorectal cancer cells    115152114 GTP-binding proteins [BR:stru04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     115152114 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin G-alpha AAA_16 Motif Other DBs NCBI-GeneID:  115152114 NCBI-ProteinID:  XP_029552502 Ensembl:  ENSSTUG00000042755 LinkDB All DBs Position 17:complement(35068766..35110690) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PACTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagttggtggtggtgggggcaggaggtgtgggaaagagtgcactcacc atccagcttatccagaaccactttgtggatgaatacgaccccaccatagaggactcgtac aggaagcaggtggtgattgatggggagacatgtctgctggacatcctggacactgcaggt caggaggagtacagcgctatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtcctttgaggacatccaccagtacagggaacagatc aagcgtgtgaaggactctgacgatgtaccgatggtgctggtgggtaataaatgtgacctc ccggcgtgtaccgtggacacgcggcaagcacaggaactggcccgcagctatggaattccc tacattgagacctcagccaagacacgacagggggtagaggatgccttctacacactagtg agagagatcagacaacacaagctgaggaagctcaaccctcctgacgagagcgggcaggac tgcatgagctgccgctgtgtggtgtcttga

DBGET integrated database retrieval system