Salmo trutta (river trout): 115154791 Help Entry 115154791         CDS       T08542                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism stru  Salmo trutta (river trout) Brite KEGG Orthology (KO) [BR:stru00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:stru01002]     115154791   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115154791 Peptidases and inhibitors [BR:stru01002]  Peptidase inhibitors   Family I25: cystatin family    115154791 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    115154791 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  115154791 NCBI-ProteinID:  XP_029557237 Ensembl:  ENSSTUG00000006600 UniProt:  A0A673WQH4 LinkDB All DBs Position 19:complement(46345101..46346564) Genome browser AA seq 99 aa AA seqDB search MMMCGAVSQVSNATPEVQQICDKMKPHAEKKAGKKFDVFTAKTFTTQVVAGTNFFIKVHV GGDEYMHLRVHKTLPHAGGKLELHGVQTPKTHNDPIGFF NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgatgatgtgcggagctgtttcccaggtgagcaacgccacgcctgaagtgcagcaaata tgcgataagatgaagccacatgcagagaagaaagctggaaagaagtttgatgttttcacc gccaaaacattcacaacccaagttgtagctgggaccaacttcttcattaaagtccatgtt ggtggagatgaatatatgcacctgcgcgtccataaaacactaccccacgctggcgggaaa ctggagctgcatggagtacagactccaaaaactcacaatgaccctattggtttcttctga

DBGET integrated database retrieval system