Salmo trutta (river trout): 115159759 Help Entry 115159759         CDS       T08542                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism stru  Salmo trutta (river trout) Pathway stru04137   Mitophagy - animal stru04140   Autophagy - animal stru04144   Endocytosis stru04145   Phagosome stru04148   Efferocytosis stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115159759    04145 Phagosome     115159759    04140 Autophagy - animal     115159759    04137 Mitophagy - animal     115159759    04148 Efferocytosis     115159759  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115159759  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:stru04131]     115159759   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115159759    04031 GTP-binding proteins [BR:stru04031]     115159759 Membrane trafficking [BR:stru04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     115159759 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115159759   Exosomal proteins of other body fluids (saliva and urine)    115159759   Exosomal proteins of colorectal cancer cells    115159759   Exosomal proteins of bladder cancer cells    115159759 GTP-binding proteins [BR:stru04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     115159759 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 nSTAND3 PduV-EutP AAA_16 NTPase_1 Septin AAA_22 AAA_24 AAA_7 DUF5992 AAA_5 ATPase_2 SRPRB NACHT ABC_tran NB-ARC Motif Other DBs NCBI-GeneID:  115159759 NCBI-ProteinID:  XP_029565653 Ensembl:  ENSSTUG00000043582 LinkDB All DBs Position 23:complement(29775731..29780338) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKRFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPDNFPF VVLGNKIDLENRQVTTKRAQAWCASKNNIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRPSSSSDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcctcccgtaagaaggtgctgctgaaggtgatcatcctcggagactctggggtaggg aagacatctctgatgaaccagtatgtaaataagaggttcagtaaccaatacaaggccact ataggagctgacttcctcaccaaggaggtgatggtggatgacaggctggtcaccatgcag atctgggacacggcggggcaggagcggtttcaatctctgggtgtggcgttctaccgtggg gctgactgctgtgtgctggtctatgatgtcacagcgcccaacacctttaagactctggac agttggagggatgagttcctgatccaggccagccccagagacccagataacttccccttt gtggtgctaggcaacaagattgacctcgagaatagacaggtgacgacaaagcgtgcccag gcctggtgtgccagtaagaacaacatcccctactttgagaccagtgccaaggaggccatc aacgtagaccaagcattccagaccatcgcccgcaacgccctcaaacaggagtctgaggtg gagacgtatgacttcccagaccagatcaaactgagagacgaccggccctcctcctccagc gacggctgctcctgctga

DBGET integrated database retrieval system