Salmo trutta (river trout): 115162182 Help Entry 115162182         CDS       T08542                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism stru  Salmo trutta (river trout) Pathway stru04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:stru00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     115162182  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:stru04121]     115162182    03400 DNA repair and recombination proteins [BR:stru03400]     115162182 Ubiquitin system [BR:stru04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      115162182    Cul5 complex      115162182 DNA repair and recombination proteins [BR:stru03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      115162182 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  115162182 NCBI-ProteinID:  XP_029569102 UniProt:  A0A674DRB3 LinkDB All DBs Position 2:70396073..70415600 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRQKTTIFTDAKESTTVYELKRIVEGILKREPEEQRLFKDDQLLEDSKTLGDC GFTNQTARPQAPGTVGLAFRMGDEMFEQLQVEEFSSPPELPDVMKPQDSGSTANEQTVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttccttatgatccggcgtcagaagaccaccattttcacagacgccaaagag tccaccaccgtctacgagctgaagcgcattgtcgagggaattctcaagagagagcctgag gaacagaggctcttcaaggatgaccagttgctagaagacagtaaaactcttggcgattgc ggcttcaccaaccagactgcaagacctcaggccccaggcactgttggactggctttccga atgggcgatgagatgtttgagcagctgcaggtggaggaattctccagccctccagagctc cctgacgtcatgaagccccaagactctggcagcactgccaacgaacagactgtgcagtga

DBGET integrated database retrieval system