Salmo trutta (river trout): 115171360 Help Entry 115171360         CDS       T08542                                  Name (RefSeq) permeability factor 2-like   KO K10030   interleukin 8 Organism stru  Salmo trutta (river trout) Pathway stru04060   Cytokine-cytokine receptor interaction stru04218   Cellular senescence stru04620   Toll-like receptor signaling pathway stru04621   NOD-like receptor signaling pathway stru04622   RIG-I-like receptor signaling pathway stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     115171360  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     115171360  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     115171360    04621 NOD-like receptor signaling pathway     115171360    04622 RIG-I-like receptor signaling pathway     115171360  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115171360  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:stru04052]     115171360    00536 Glycosaminoglycan binding proteins [BR:stru00536]     115171360 Cytokines and neuropeptides [BR:stru04052]  Cytokines   Chemokines    115171360 Glycosaminoglycan binding proteins [BR:stru00536]  Heparan sulfate / Heparin   Chemokines    115171360 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  115171360 NCBI-ProteinID:  XP_029583959 LinkDB All DBs Position 32:complement(20221857..20223901) Genome browser AA seq 97 aa AA seqDB search MSIRMSASLVVVLLALLTITEGMSLRGVGADLRCRCIETESRRIGKLIKKVEMFPPSSHC RDTEIIATLSNSGQEICLDVSAPWVKRVIEKMLANNK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagcatcagaatgtcagccagccttgtcgttgtgctcctggccctcctgaccattact gaggggatgagtctgagaggcgtgggggctgacctgcgatgtcgctgcattgagacagag agcagacgtattggtaaactcattaagaaggtggagatgttccctcccagctcgcactgc agagacactgagatcattgccactctgagcaacagcggtcaggagatttgtctggatgtc agcgctccttgggtcaagagggtcattgagaagatgctggccaacaacaaatga

DBGET integrated database retrieval system