Salmo trutta (river trout): 115171511 Help Entry 115171511         CDS       T08542                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism stru  Salmo trutta (river trout) Pathway stru04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:stru00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     115171511  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:stru04121]     115171511    03400 DNA repair and recombination proteins [BR:stru03400]     115171511 Ubiquitin system [BR:stru04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      115171511    Cul5 complex      115171511 DNA repair and recombination proteins [BR:stru03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      115171511 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  115171511 NCBI-ProteinID:  XP_029584288 Ensembl:  ENSSTUG00000009917 LinkDB All DBs Position 32:complement(24499894..24503483) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLYKDDMLLEDSKTLGDC GFTNQTARPQAPGTVGLAFRLGDDAFEQLRVEPFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctgatgatccggcgtcacaagacgaccatcttcactgatgccaaagag tccactacggtctacgagctgaagcgcatagtggagggtatcctaaagagggcaccggag gaacagaggctgtacaaggatgacatgttgctggaggatagtaagactcttggagactgt ggcttcacaaatcaaacagccagacctcaggccccagggactgttggattagctttccgt ctcggtgatgatgcatttgagcagctgagggttgagcccttctccagccccccagagctt cctgacgtcatgaagcctcaggactctggcagcacagccaatgagcaggctgtgcagtga

DBGET integrated database retrieval system