Salmo trutta (river trout): 115173280 Help Entry 115173280         CDS       T08542                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism stru  Salmo trutta (river trout) Pathway stru04382   Cornified envelope formation stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     115173280  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115173280  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115173280 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of microglial cells    115173280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 NNH2 DAXX_hist_bd Bcl-2 Motif Other DBs NCBI-GeneID:  115173280 NCBI-ProteinID:  XP_029587092 Ensembl:  ENSSTUG00000042289 UniProt:  A0A674DFZ3 LinkDB All DBs Position 34:1135429..1137716 Genome browser AA seq 99 aa AA seqDB search MPSELERAMESMITVFHKYAAKEGSGNTLSRRELKDLMENELSGFLKSQKDPTTVDKIMK DLDSNGDGEVNFEEFVSLVVGLSIACEQCYQMHKKKMGK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccgtcagaactggaacgtgccatggagtccatgatcaccgtgttccacaagtatgct gctaaggagggcagtggcaacactctgagccgccgtgagctcaaggacctgatggagaac gagctctctggcttcctcaagtctcagaaggacccaaccacagtagacaagataatgaag gatctggactctaatggtgacggagaggtgaactttgaggagtttgtttctctagtcgtg ggtctgtccatcgcgtgtgaacagtgctaccagatgcacaagaagaagatggggaagtga

DBGET integrated database retrieval system