Salmo trutta (river trout): 115177603 Help Entry 115177603         CDS       T08542                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism stru  Salmo trutta (river trout) Brite KEGG Orthology (KO) [BR:stru00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:stru03041]     115177603   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:stru04052]     115177603 Spliceosome [BR:stru03041]  Complex B   Other components    Complex B specific factors     115177603 Cytokines and neuropeptides [BR:stru04052]  Neuropeptides   Unclassified    115177603 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  115177603 NCBI-ProteinID:  XP_029594357 Ensembl:  ENSSTUG00000020430 LinkDB All DBs Position 38:complement(25545321..25549430) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVSLGDY EIHDGQNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtttgcaacgaccggctgggcaagaaggtccgggtgaagtgcaactca gaagacactataggagacctgaagaagctcatcgctgcccagacaggcacacggtgggac aagatcgtactcaagaaatggtacaccatattcaaggaccacgtgtctctgggagactat gagatccatgatgggcagaacctggagctgtactaccagtag

DBGET integrated database retrieval system