Salmo trutta (river trout): 115182331 Help Entry 115182331         CDS       T08542                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism stru  Salmo trutta (river trout) Pathway stru04382   Cornified envelope formation stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     115182331  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115182331  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115182331 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of microglial cells    115182331 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 Rep3_C DEK_C HalOD1 Astro_p19 Motif Other DBs NCBI-GeneID:  115182331 NCBI-ProteinID:  XP_029599805 Ensembl:  ENSSTUG00000022571 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MPSQLERSMESLITVFHRYADKDGDCNTLSKKELKELMQTELDSFLKSQKDPAAIDKIMK DLDQNGDGKVSFEEFVSLVVGLSIACEQIYQLHTQKVAAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcagttggagagatccatggagtccctgatcacggtgttccatcgctatgcc gacaaggatggtgactgtaacacactgagcaagaaggagctgaaagagctgatgcagaca gaactggacagcttcctgaagtctcagaaggacccagccgccatagacaagatcatgaag gatctggaccagaatggtgatgggaaggtgagcttcgaggagtttgtctctctggtggtg ggcctctccatcgcctgtgaacagatctaccagctccacacccagaaggttgctgccaag aagtga

DBGET integrated database retrieval system