Salmo trutta (river trout): 115182983 Help Entry 115182983         CDS       T08542                                  Symbol dynlt1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism stru  Salmo trutta (river trout) Pathway stru04814   Motor proteins stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     115182983 (dynlt1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115182983 (dynlt1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:stru03037]     115182983 (dynlt1)    04812 Cytoskeleton proteins [BR:stru04812]     115182983 (dynlt1) Cilium and associated proteins [BR:stru03037]  Motile cilia and associated proteins   Dynein arm    115182983 (dynlt1) Cytoskeleton proteins [BR:stru04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      115182983 (dynlt1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  115182983 NCBI-ProteinID:  XP_029600225 Ensembl:  ENSSTUG00000022563 UniProt:  A0A674A4Y4 LinkDB All DBs Position 1:21626434..21628035 Genome browser AA seq 113 aa AA seqDB search MDEFQTGEETAFVVDEVSTIIKESVEGAIGGNAYQHSRVNQWTTNVVEQSLSQLSKLGKP FKYIVTCVIMQKNGAGLQTASSCFWDNTTDGSCTVRWENKSMYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggatgagtttcagactggagaagagactgcctttgtcgttgacgaagtgagcactatc atcaaagagtcagtagaaggagccataggagggaatgcctatcaacatagcagagtgaac caatggaccaccaatgtagtggagcagtccctgagtcaacttagcaaactgggcaagcct ttcaagtacattgtgacctgtgttatcatgcagaagaatggggcaggtctacagacagcc agctcgtgcttctgggataacaccactgatggaagctgtacagtgaggtgggagaataaa tccatgtactgcatcgtcagtgtcttcggcctggccatctga

DBGET integrated database retrieval system